LL-37 (Leu-Leu-37) — Research Use Only
LL-37 (Leu-Leu-37) is a synthetic cationic antimicrobial peptide derived from the human cathelicidin protein hCAP‑18. It is referenced in scientific literature for experimental and analytical research involving innate immune response, antimicrobial activity, inflammatory signaling, and host defense mechanisms. This peptide is supplied exclusively for laboratory research applications, including in vitro experiments and analytical investigations.
Manufactured to high purity standards, LL-37 is intended strictly for non-clinical research use by qualified personnel.
Product Specifications
Peptide Name: LL-37 (Leu-Leu-37)
CAS Number: 154947-66-7
Peptide Sequence: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight: ~4493 Da
Form: Lyophilized powder
Purity: ≥ 99% (HPLC verified)
Solubility: Soluble in sterile water, acetic acid (0.01%), or appropriate laboratory buffers
Analytical documentation and batch certificates are available upon request for research verification.
Intended Research Applications
✔ Innate immunity and antimicrobial mechanism studies
✔ In vitro inflammatory signaling assays
✔ Host-pathogen interaction research
✔ Peptide structure-function and membrane interaction investigations
Applications listed are for informational purposes only and do not imply approved or intended medical, therapeutic, or diagnostic use.
Storage & Handling
Store at ≤ −20 °C for long-term stability
Protect from moisture, heat, and direct light
Handle using appropriate laboratory PPE
Reconstitute and dispose of material according to institutional laboratory protocols
Regulatory & Safety Disclaimer
FOR RESEARCH USE ONLY. NOT FOR HUMAN OR ANIMAL CONSUMPTION.
This product is sold strictly as a research chemical. It is not intended for human use, therapeutic use, diagnostic use, or veterinary use. This compound has not been evaluated, approved, or licensed by Health Canada, the FDA, or any other regulatory authority.
The purchaser acknowledges that this product will be handled only by qualified personnel in a laboratory setting and assumes full responsibility for compliance with all applicable Canadian laws, regulations, and institutional guidelines.
| Vial Size |
|---|
Only logged in customers who have purchased this product may leave a review.




Reviews
There are no reviews yet.